PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr015612.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 142aa    MW: 15933.3 Da    PI: 8.469
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr015612.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26093.72.1e-29690185
       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85
                 aCaaCk++rrkC++ C la yfpa++  +f n++++FG+sn+ k+++++++++r++a+ ++++e+++r ++P  G++  i++  q
  Pbr015612.1  6 ACAACKYQRRKCNQTCELAAYFPASRFVEFVNAQHMFGMSNIEKIIATVEPDQRPAAAVTILFEGNIRRNNPSVGCLVGIKTAAQ 90
                 7***************************************************************************988876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.5325106IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-26690IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MANSKACAAC KYQRRKCNQT CELAAYFPAS RFVEFVNAQH MFGMSNIEKI IATVEPDQRP  60
AAAVTILFEG NIRRNNPSVG CLVGIKTAAQ FAQNTISTRS IIPDQFPRIT AEMKKYEERY  120
IYMSSLEDAQ EKAFDIGLMQ Y*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352702.19e-75PREDICTED: LOB domain-containing protein 22-like
TrEMBLM5VSQ03e-32M5VSQ0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-27LOB domain-containing protein 22